SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005672 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005672
Domain Number 1 Region: 155-261
Classification Level Classification E-value
Superfamily ERP29 C domain-like 5.49e-30
Family ERP29 C domain-like 0.00000324
Further Details:      
 
Domain Number 2 Region: 36-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.32e-24
Family ERP29 N domain-like 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005672   Gene: ENSPPYG00000004971   Transcript: ENSPPYT00000005889
Sequence length 261
Comment pep:known_by_projection chromosome:PPYG2:12:113883198:113896375:1 gene:ENSPPYG00000004971 transcript:ENSPPYT00000005889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPRAASLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQAL
LKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEE
LQKSLNILTAFQKKGAEKEEL
Download sequence
Identical sequences H2NIQ0 H2Q6W7
ENSPTRP00000009282 9598.ENSPTRP00000009282 9600.ENSPPYP00000005672 ENSPTRP00000009282 ENSPPYP00000005672 ENSPPYP00000005672 XP_001139225.2.37143 XP_002823812.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]