SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005766 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005766
Domain Number 1 Region: 675-755
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005766   Gene: ENSPPYG00000005061   Transcript: ENSPPYT00000005986
Sequence length 875
Comment pep:known_by_projection chromosome:PPYG2:12:124388136:124479051:1 gene:ENSPPYG00000005061 transcript:ENSPPYT00000005986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AATPARAHASAAPPPPRAGPGREEPPRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQ
TCQTYSFGKTSSCHLSIDASLTKLFECMTLAYSGKLVSPKWKNFKGLKLQWRDKIRLNNA
IWRAWYMQYLEKRKNPVCHFVTPLDGSVDVDEHRRPEAITTEGKYWKSRIEIVIREYHKW
RTYFKKRLQQHKDEDLSSLVQDDDMLYWHKHGDGWKTPVPMEEDPLLDTDMLMSEFSDTL
FSTLSSHQPVAWPNPREIAHLGNADMIQPGLIPLQPNLDFMDTFEPFQDLFSSSRSIFGS
MLPASASAPVPDPNNPPAQESILPTTALPTVSLPDSLIAPPTAPSLAHVDGQGCEHTSRT
EDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPPPISPVLPLVPPPATALNPPAP
PTFHQPQKFAGVNKAPSVITHTASATLTHDASATTFSQSQGLVITTHHPAPSAAPCGLAL
SPVTRPPQPRLTFVHPKPVSLTGGRPKQPHKIVPAPTKPEPVSLVLKNACIAPAAFSGQP
QAVIMTSGPLKREGMLASTVSQSNMVIAPAAIARAPGVPEFHSSILVTDLGHGTSSPPAP
VSRLFPSTAQDPLGKGEQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNN
CSGKSDPKNVAALKNRQMKHISAEQKRRFNIKMCFDMLNSLISNNSKLTSHAITLQKTVE
YITKLQQERGQMQEEARRLREEIEELNATIISCQQLLPATGVPVTRRQFDHMKDMFDEYV
KSRTLQNWKFWIFSIIIKPLFESFKGMVSTSSLEELHRTALSWLDQHCSLPILRPMVLST
LRQLSTSTSILTDPAQLPEQASKAVTRIGKRLGES
Download sequence
Identical sequences H2NIY9
9600.ENSPPYP00000005766 ENSPPYP00000005766 ENSPPYP00000005766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]