SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005772 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005772
Domain Number 1 Region: 183-336
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.06e-43
Family Cap-Gly domain 0.0000000628
Further Details:      
 
Domain Number 2 Region: 36-163
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.41e-36
Family Cap-Gly domain 0.00000215
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005772
Domain Number - Region: 829-933
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00204
Family Myosin rod fragments 0.0021
Further Details:      
 
Domain Number - Region: 1399-1433
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00767
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005772   Gene: ENSPPYG00000005067   Transcript: ENSPPYT00000005992
Sequence length 1438
Comment pep:known_by_projection chromosome:PPYG2:12:124607715:124759891:-1 gene:ENSPPYG00000005067 transcript:ENSPPYT00000005992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRV
GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
PSKLTRKVQAEDEANGLQTTPASRATSPLCTSTASMVSSSPATPSNIPQKPSQPVAKEPS
ATPLISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGE
WCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVM
ATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEK
QQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA
DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKEL
EQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAG
DVDMSLSLLQEISSLQEKLEVTRTDHQKEITSLKEHFGAREETHQKEIKALYTATEKLSK
ENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELK
TQIEKMRLDYQHEIENLQNQQDSERSAHAKEMEALRAKLMKVIKEKENSLEAIKSKLDKA
EDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQSKVIDNFTSQLKATEEKLLDLDALQ
KASSEGKSEMEKLRQQLEAAEKQIKHLEIEKKAESSKVSSITRELQGRELKLTNLQENLS
EVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNLLSSDLEKLRE
NLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERYVEE
LQLKLTKANENASFLQKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHN
QCQELKARYERATSETKTKHEEILQNLQKTLLDTEDKLKGAREENSGLLQELEELRKQAD
KAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNVEELNKS
KELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLE
EERSVLNNQLLEMKKRESEFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLR
GENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNMDTQADEDERAQE
SQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCD
ICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF
Download sequence
Identical sequences H2NIZ5
9600.ENSPPYP00000005772 ENSPPYP00000005772 ENSPPYP00000005772 XP_002823952.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]