SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005873 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005873
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-25
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 2 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 407-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000158
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005873   Gene: ENSPPYG00000005153   Transcript: ENSPPYT00000006100
Sequence length 457
Comment pep:known_by_projection chromosome:PPYG2:12:136203050:136227466:1 gene:ENSPPYG00000005153 transcript:ENSPPYT00000006100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGLVTFRDVAIDFSQEEWKWLQPAQRDLYRCVMLENYGHLVSLGLSISKPDVVSLLEQ
GKEPWLGKREVKRDLFSVSESSGEIKDFSAKNVIYDDSSQYLIMERILSQGPVYSSFKGG
WKCKDHTEMLQENQGCIRKITVSHQEALAQHMHISTVERPYGCHECGKTFGRRFSLVLHQ
RTHTGEKPYACKECGKTFSQISNLVKHQMIHTGKKPHECKDCNKTFSYLSFLIEHQRTHT
GEKPYECTECGKAFSRASNLTRHQRIHIGKKQYICRKCGKAFSSGSELIRHQITHTGEKP
YECIECGKAFRRFSHLTRHQSIHTTKTPYECNECRKAFRCHSFLIKHQRIHAGEKLYECD
ECGKVFTWHASLIQHTKTHTGEKPYACAECDKAFSRSFSLILHQRTHTGEKPYVCKVCNK
SFSWSSNLAKHQRTHTLDNPYEYENSFNYHSFLTEHQ
Download sequence
Identical sequences H2NJ85
XP_009246725.1.23681 ENSPPYP00000005873 ENSPPYP00000005873 9600.ENSPPYP00000005873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]