SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005874 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005874
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-24
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 2 Region: 131-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 205-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005874   Gene: ENSPPYG00000005154   Transcript: ENSPPYT00000006101
Sequence length 262
Comment pep:known_by_projection chromosome:PPYG2:12:136238934:136240448:-1 gene:ENSPPYG00000005154 transcript:ENSPPYT00000006101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAVFLTTWLQEPMTFKDVAVEFTQEEWMLLDSAQRSLYRDVMLENYRNLTSVEYQLCGL
TVTSPLDQEEIRNMKKRIPQAICPDQKIQPKTKESTVQKILWEEPSNAVKMIKLTMHNWS
STLREDWECHNQKTSLKAHMRTHTGEKPYECNQCGKSFGTSSYLIVHKRIHTGEKLYECS
ECRKAFNTSSHLKVHKKIHTGENLMHIRTHTGEKPYECKECRKAFSVSSSLRRHVRIHTG
EKPYECIQCGKAFSQSSSLIIH
Download sequence
Identical sequences H2NJ86
ENSPPYP00000005874 9600.ENSPPYP00000005874 ENSPPYP00000005874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]