SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006010 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006010
Domain Number 1 Region: 197-257
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006010   Gene: ENSPPYG00000005276   Transcript: ENSPPYT00000006245
Sequence length 425
Comment pep:novel chromosome:PPYG2:13:35883878:35950562:-1 gene:ENSPPYG00000005276 transcript:ENSPPYT00000006245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALL
DDCTFNMVFLKMPSSLSAEELEDIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGTDIAL
TEPLTMEKMSNVVKYWKTCPSNTVKIENATGPEEPGLPLQRSYSEHLGYFPTDLFACPES
LRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAAS
VLEATVDYVKYIREKISPAIMAQITEALQNNRRFCKKQQTPIELSLPGTVMAQRENSVTS
TYSPERGLQFLTNTCWNGCSTPDPEGSLDEAVRVPSSSTSENAVGDPYKTHIPSAALSLN
SLHTVRYYSKVTPSYDATAVTNQNISIHLPSAVSPVSKLLPQHCTSGLGQTCTTHPNCLQ
QFWAY
Download sequence
Identical sequences H2NJL8
9600.ENSPPYP00000006010 ENSPPYP00000006010 ENSPPYP00000006010 XP_009246844.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]