SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006014 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000006014
Domain Number - Region: 3-71
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000167
Family Myosin rod fragments 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006014   Gene: ENSPPYG00000005278   Transcript: ENSPPYT00000006249
Sequence length 110
Comment pep:known_by_projection chromosome:PPYG2:13:35967846:36020467:-1 gene:ENSPPYG00000005278 transcript:ENSPPYT00000006249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVESLNTLLKQLEKEKRTLESQVKYYALKLEQESKAYQKINNERCTYLAEMSQGSGHQV
SKRQQMHQLRMQENLVKTGRYNPAKQKIVSAKRGPVKKITRPNHLPELHP
Download sequence
Identical sequences H2NJM2
9600.ENSPPYP00000006014 ENSPPYP00000006014 ENSPPYP00000006014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]