SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006048 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006048
Domain Number 1 Region: 167-198
Classification Level Classification E-value
Superfamily WW domain 0.00000000027
Family WW domain 0.0011
Further Details:      
 
Domain Number 2 Region: 126-158
Classification Level Classification E-value
Superfamily WW domain 0.00000000719
Family WW domain 0.00024
Further Details:      
 
Domain Number 3 Region: 9-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000028
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006048   Gene: ENSPPYG00000005310   Transcript: ENSPPYT00000006285
Sequence length 375
Comment pep:known_by_projection chromosome:PPYG2:13:41020302:41042600:1 gene:ENSPPYG00000005310 transcript:ENSPPYT00000006285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKRKK
DPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGNLKKTAVKTVWVEGLSEDGFTYY
YNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGEVS
TETEKPKIKFKEKNKNSDGGSDSETQKEKSIQKQNSLGPNEEKSKTLKKSNPYGEWQEIK
QEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRRT
ENGKSRNLRQRGDDQ
Download sequence
Identical sequences H2NJQ5
XP_002824252.1.23681 ENSPPYP00000006048 9600.ENSPPYP00000006048 ENSPPYP00000006048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]