SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006140 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006140
Domain Number 1 Region: 343-393
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000379
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006140   Gene: ENSPPYG00000005389   Transcript: ENSPPYT00000006382
Sequence length 853
Comment pep:known chromosome:PPYG2:13:52647568:52674955:-1 gene:ENSPPYG00000005389 transcript:ENSPPYT00000006382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPMLKDFSNLLLVVLCDYVLGEAEYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVS
VLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKS
AFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARR
NSRQPLEIRTSKRTELAQGQWVEFGCAPVGPEAYVTVVLKLLGRDSVITSTGPIDLAQKF
GYKLVMVPELTCESGVEVMVLPPPCTFVQGVVTVFKEAPRSPGKRTIHLAENSLPLGERR
TIFNCTLFDMGKNKYCFDFGISSRSHFSAKEKECMLIQRNIETWGLWQPWSQCSATCGDG
VRERRRVCLTSFPSRPGCPGMSLEASLCSLEECAAFQPSSPSPLQPQGPVKSNNIVTVTG
ISLCLFIIIATVLITLWRRFGRPAKCSTPARHNSIHSPSFRKNSDEENICELSEQRGSFS
DGGDGPTGSPGDTGIPLTYRRSGPVPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKE
MKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSA
GERPPSRLDLSVTQASCAISPSQTLIRKSQARHVGSRGGPSERSHARNAHFRRTASFHEA
RQARPFRERSMSTLTPRQAPAYSTRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTG
GPLNPLPKSYTLGQPLRKPDLGDRQAGLVAGIERTEPHRARRGPSPSHKSVSRKQSSPTS
PKDSYQRVSPLSPSQCRKDKCQSFPTHPEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEED
ETTSTLSVEKLVI
Download sequence
Identical sequences H2NJZ1
ENSPPYP00000006140 ENSPPYP00000006140 9600.ENSPPYP00000006139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]