SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006305 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006305
Domain Number 1 Region: 260-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-40
Family Laminin G-like module 0.00000000497
Further Details:      
 
Domain Number 2 Region: 463-672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.47e-35
Family Laminin G-like module 0.00000000331
Further Details:      
 
Domain Number 3 Region: 48-105
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-20
Family GLA-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 159-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000006
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 193-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 6 Region: 117-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000281
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006305
Domain Number - Region: 245-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0533
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006305   Gene: ENSPPYG00000005531   Transcript: ENSPPYT00000006553
Sequence length 677
Comment pep:known_by_projection chromosome:PPYG2:13:116456693:116507900:1 gene:ENSPPYG00000005531 transcript:ENSPPYT00000006553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSLSPGPAALRRALQLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHL
ERECVEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQCT
PNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCA
CHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCEEGFAYSSREKACRDVDE
CLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRMF
SGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLRY
NGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLNL
TVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFYP
GSGFAFYSLDYMQTPLDIGTESTWEIEVVAHIRPAADTGVLFALWVPDLRAVPLSVALVD
YHSTKKLKKQLVVLAVEHVALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVST
AQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYK
HSDITAHSCPPVEPTTA
Download sequence
Identical sequences H2NKE7
9600.ENSPPYP00000006305 ENSPPYP00000006305 ENSPPYP00000006305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]