SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006311 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006311
Domain Number 1 Region: 737-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000502
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006311
Domain Number - Region: 15-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0894
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006311   Gene: ENSPPYG00000005537   Transcript: ENSPPYT00000006559
Sequence length 813
Comment pep:known_by_projection chromosome:PPYG2:13:117045864:117048305:1 gene:ENSPPYG00000005537 transcript:ENSPPYT00000006559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAK
LFHCHKCFFTSKMYSNVYYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCN
SAEPKSIPALSMETQKLGSVLSPESPKPTPVTPLEPQKPGSVVSPELQTPLPSPEPSKPA
CVSSPEPPKPVPVCESQKPAPVPSPEPQKLAPVSPEPVKATLSNPKPQKHSHFPETLGPP
SASSPESPVLAASPEPWGPSPAASPESRKSARTTSPELRKPSPSESPEPWKPFPAVSPEP
RRPAPAVSPGSWKPGPPGSPRPWKSSPSASSGPWKPAKPAPSVSPGPWKPIPSISPGPWK
PTPSSVSSASWKSSSVSPSSWKSPPASPESWKSGPPELRKTAPTLSPEHWKAVPPVSPEL
RKPGPPLSPEIRSPAGSPELRKPSGSPDLWKLSPDQRKTSPASLDFPESQKSSRGGSPDL
WKSSFFIEPQKPVFPETRKPGPSGPSESPKAASDIWKPVLSIDNEPRKPALFPEPAKTAP
PASPEPRKRALFPEPRKHALFPELPKSALFSESQKDVELGDELQIDAIDDQKCDILVQEE
LLASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDIKGQESSSDQEQVD
VESIDFSKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAM
KKGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRG
FKKHLTHCQSRHNEEANKKLMEALEPPLEEQQI
Download sequence
Identical sequences H2NKF3
ENSPPYP00000006311 XP_002824529.3.23681 XP_003778298.2.23681 XP_003778299.2.23681 ENSPPYP00000006311 9600.ENSPPYP00000006311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]