SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006318 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006318
Domain Number 1 Region: 78-164
Classification Level Classification E-value
Superfamily HMG-box 3.27e-32
Family HMG-box 0.00000625
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 9.43e-27
Family HMG-box 0.00000511
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006318
Domain Number - Region: 167-212
Classification Level Classification E-value
Superfamily ARM repeat 0.00101
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006318   Gene: ENSPPYG00000005546   Transcript: ENSPPYT00000006568
Sequence length 215
Comment pep:novel chromosome:PPYG2:13_random:10080129:10083967:-1 gene:ENSPPYG00000005546 transcript:ENSPPYT00000006568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Download sequence
Identical sequences A0A024RDR0 A0A091DMI8 A0A0D9SB94 A0A1U7STP3 A0A250YCD0 A0A286XER8 A0A2K5EHM8 A0A2K5KWZ0 A0A2K5ZE73 A0A2K6BBR2 A9RA84 B0CM99 B1MTB0 B2KI23 B4USW9 B7NZ89 F6Y7C3 G1QIX9 G3SGE0 G3SLE0 G5B268 H2NKG0 K9K2L5 P09429 Q08IE6 Q4R844 Q6YKA4
9600.ENSPPYP00000006318 9606.ENSP00000343040 9615.ENSCAFP00000009862 9796.ENSECAP00000006518 gi|4504425|ref|NP_002119.1| ENSECAP00000006518 ENSCJAP00000013164 ENSP00000343040 ENSP00000345347 ENSP00000382417 ENSP00000384678 ENSPPYP00000006318 NP_001002937.1.84170 NP_001075304.1.31192 NP_001164752.1.1745 NP_001252735.1.72884 NP_001270285.1.63531 NP_001300821.1.87134 NP_001300821.1.92137 NP_001300822.1.87134 NP_001300822.1.92137 NP_002119.1.87134 NP_002119.1.92137 XP_002715999.1.1745 XP_002833818.1.23681 XP_003270282.1.23891 XP_003270287.1.23891 XP_003270288.1.23891 XP_003270289.1.23891 XP_003414007.1.64505 XP_004088964.1.23891 XP_004088965.1.23891 XP_004088966.1.23891 XP_004435354.1.5094 XP_004680237.1.23501 XP_004680238.1.23501 XP_004854841.1.39548 XP_007999352.1.81039 XP_008051234.1.4292 XP_008051235.1.4292 XP_008264243.1.1745 XP_008271738.1.1745 XP_008515751.1.77740 XP_008515760.1.77740 XP_008690416.1.72690 XP_008690417.1.72690 XP_008823264.1.79516 XP_008996337.1.60252 XP_010622174.1.5607 XP_011746906.1.29376 XP_011746907.1.29376 XP_011746908.1.29376 XP_011823218.1.47321 XP_011823219.1.47321 XP_011823220.1.47321 XP_011823221.1.47321 XP_011823223.1.47321 XP_011823224.1.47321 XP_011823225.1.47321 XP_011920039.1.92194 XP_012329548.1.9421 XP_012357439.1.23891 XP_012578766.1.23501 XP_012601980.2.48125 XP_012996635.1.53824 XP_012996636.1.53824 XP_013962798.1.84170 XP_014687426.1.49734 XP_015339670.1.40921 XP_017651585.1.79516 XP_017651586.1.79516 XP_018895114.1.27298 XP_019592052.1.88060 XP_020008286.1.5219 XP_020030779.1.5219 XP_020030780.1.5219 XP_021534019.1.83697 ENSECAP00000006518 ENSPPYP00000006318 ENSP00000343040 ENSLAFP00000000221 ENSMMUP00000036446 ENSNLEP00000000873 GO.38562 ENSMICP00000006501 ENSP00000343040 ENSP00000345347 ENSP00000382417 ENSP00000384678 ENSCAFP00000009862 HGL_H00000419072-3 ENSPANP00000006640 ENSPANP00000013674 ENSLAFP00000000221 ENSNLEP00000000873 ENSCAFP00000009862 ENSMICP00000006501 ENSCJAP00000040230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]