SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006319 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006319
Domain Number 1 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 15-68
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 101-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 57-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000163
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006319   Gene: ENSPPYG00000005547   Transcript: ENSPPYT00000006569
Sequence length 195
Comment pep:novel chromosome:PPYG2:14:18456761:18457485:-1 gene:ENSPPYG00000005547 transcript:ENSPPYT00000006569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHAEEKPYKCEECVSSNLTIHKRIHTGEKPYNCEKCGKAFYCSSNLIQHNIVHTEEKHYK
CQECGKAFKKPLDLNVNKKIHSGEKPYREECGKVTHSEEESYKCEEFGKGFYCSSSLTKH
KIVHTEGKLHKCEECGKAFKWSSELTIHQRIHTEEKPYKCEECVRVFKHSSKLNEHKRNH
TGEKPYKCEACGKAF
Download sequence
Identical sequences H2NKG1
ENSPPYP00000006319 ENSPPYP00000006319 9600.ENSPPYP00000006319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]