SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006367 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006367
Domain Number 1 Region: 210-302
Classification Level Classification E-value
Superfamily HMG-box 2.49e-25
Family HMG-box 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006367   Gene: ENSPPYG00000005598   Transcript: ENSPPYT00000006622
Sequence length 615
Comment pep:known chromosome:PPYG2:14:20860122:20880971:1 gene:ENSPPYG00000005598 transcript:ENSPPYT00000006622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFD
DLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANP
PVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPT
SSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAA
IKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQECQATV
ETVELDPAPPSQTPSPPPMATVDPGIQPASIVATPALSPSIVVNSTLSPSYVNQASSGAG
GRAQYSLIITKQMLPSSITMSQGWVTVIPATVVTSRGQLGQTSTATIQPSQQAQIVTRSV
LQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILSPPPLQAMQQPRTSEKFESN
LQQQPPPLQIKSVPTTLKIAELPLPPTVESSPERPMNNSPAHTVEATSETICEMITDVVP
EVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFL
AWVASRNSNTVVFVK
Download sequence
Identical sequences H2NKK5
ENSPPYP00000006367 ENSPPYP00000006367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]