SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006377 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000006377
Domain Number - Region: 33-142
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00392
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006377   Gene: ENSPPYG00000005607   Transcript: ENSPPYT00000006632
Sequence length 159
Comment pep:novel chromosome:PPYG2:14:21123222:21123698:-1 gene:ENSPPYG00000005607 transcript:ENSPPYT00000006632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLRRVLSGQDDEEQGLTVQVLDGSSLSFNTRLKWFAICFVCSIFFSILGTGLLWLPGG
IKLSAVFYTFGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCFIFTLCAALWWHK
KGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS
Download sequence
Identical sequences H2NKL5
ENSPPYP00000006377 XP_002824604.1.23681 9600.ENSPPYP00000006377 ENSPPYP00000006377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]