SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006448 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006448
Domain Number 1 Region: 996-1066
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-18
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 2 Region: 790-859
Classification Level Classification E-value
Superfamily Homeodomain-like 2.27e-17
Family Homeodomain 0.0053
Further Details:      
 
Domain Number 3 Region: 527-597
Classification Level Classification E-value
Superfamily Homeodomain-like 7.7e-17
Family Homeodomain 0.0051
Further Details:      
 
Domain Number 4 Region: 1087-1130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000229
Family HkH motif-containing C2H2 finger 0.0072
Further Details:      
 
Domain Number 5 Region: 134-158,188-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000319
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 6 Region: 617-637,709-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000276
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006448
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00445
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 1392-1418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0947
Family C2HC finger 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006448   Gene: ENSPPYG00000005671   Transcript: ENSPPYT00000006703
Sequence length 1436
Comment pep:novel chromosome:PPYG2:14:23008940:23013509:-1 gene:ENSPPYG00000005671 transcript:ENSPPYT00000006703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEAKVNCPGIEWVGSGLNEVPSSLYLLLSLLEGPNLTPEASPDPLPGPPLASVEAPDKH
SGSPGQPPSPAPSPVPEPDAQAEDGAPPPTMAEEEEGTTGELRSAEPAPADSRHPLTYRK
TTNFALDKFLDPARPFKCTVCKESFTQKNILLVHYNSVSHLHKMKKAAIDPSAPARGEAG
APPNTTAATDKPFKCTVCRVSYNQSSTLEIHMRSVLHQTRSRGTKTDSKIEGPERSQEEP
KEGDTEGEVGTEKKGPDTSGFISGLPFLSPPPPPLDLHRFPAPLFTPPVLPPFPLVPESL
LKLQQQQLLLPFYLHDLKVGPKLTLAGPAPVLSLPAATPPPPPQPPKAELAEREWERPPM
AKEGNEAGPSSPPDPLPNEAARTAAKALLENFGFELVIQYNEGKQAVPPPPTPPPPEALG
GGDKLACGACGKLFSNMLILKTHEEHVHRRFLPFEALSRYAAQFRKSYDSLYPPLAEPPK
PPDGSLDSPAPHLGPPFLVPEPEAGGTHAPEERSRAGGHWPIEEEESSRGNLPPLVPAGR
RFSRTKFTEFQTQALQSFFETSAYPKDGEVERLASLLGLASRVVVVWFQNARQKARKNAC
EGGSIPTGGGTGGASGCRHCHATFSCVFELVRHLKKCYDDQTPEEEEEEAEREEEEEEVE
EEEVEEEQGLEPPAGPEGPLPEPLDGEELSQAEATKAGGKEPEEKPTPSLSPAHTCDQCA
ISFSSQDLLTSHRRLHFLPSLQPSAPPQLLDLPLLVFGERNPLVAATSPMPGPPLKRKHE
DGSLSPTGSEAGGGGEGEPPRDKRLRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVG
LKKRVVQVWFQNTRARERKGQFRSTPGGVPSPAVKPPATATPASLPKFNLLLSKVDDGTG
REAPKREAPAFPYPTATLLGPQPFLPPGKEATTPTPEPPLPLLPPPPHSEEEGPEEPPKA
SPESEACSLSAGDLSDSSASSLAEPESPGAGGTSGGPGGGTGVPDGMGQRRYRTQMSSLQ
LKIMKACYEAYRTPTMQECEVLGEEIGLPKRVIQVWFQNARAKEKKAKLQGTGTGSTGGS
SEGPLAAPRTDCPYCDVKYDFYVSCRGHLFSRQHLAKLKEAVRAQLKSESKCYDLAPAPE
APPALKVPPATTPASMPLGAAPTLPRLAPVLLSGPALAQPPLGNLAPFNSGPAASSGLLG
LATSVLPTTTVVQTAGPGRPLPQRPAPDQTNTSTAGTTDPVPGPPTEPLGDKVSGERKPV
AAPTSSSNDALKNLKALKTTVPALLGGQFLPFPLPPAGVTAPPAVFGPQLQGAYFQQLYG
MKKGLFPMNPMIPQTLIGLLPNALLQLPPQPPEPTATAPPKPPELPAPGEGEAGEVDELL
TGSTGISTVDVTHRYLCRQCKMAFDREAPATAHQRSFCFFGRGSGGSMPPPLRVPI
Download sequence
Identical sequences H2NKT4
ENSPPYP00000006448 9600.ENSPPYP00000006448 ENSPPYP00000006448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]