SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006455 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006455
Domain Number 1 Region: 158-267
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.2e-21
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 2 Region: 302-505
Classification Level Classification E-value
Superfamily vWA-like 1.29e-20
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 3 Region: 19-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.08e-17
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006455   Gene: ENSPPYG00000005677   Transcript: ENSPPYT00000006710
Sequence length 557
Comment pep:known chromosome:PPYG2:14:23550249:23555451:1 gene:ENSPPYG00000005677 transcript:ENSPPYT00000006710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERT
EVLRSCSSPVFSRVLALEYFFEEKQPLQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQ
TKVTKPLLLKNGKTAGKSTITIVAEEVSGTNDYVQLTFRAYKLDNKDLFSKSDPFMEIYK
TNEDQSDQLVWRTEVVKNNLNPSWEPFRLSLHSLCSCDVHRPLKFLVYDYDSSGKHDFIG
EFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIM
GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAF
GFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA
EPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMR
LLDGDDGPLRCPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGIS
PGAPRPCTLATTPSPSP
Download sequence
Identical sequences A0A2I2YT19 A0A2I3RAG5 H2NKU1 O95741
ENSGGOP00000015579 ENSPPYP00000006455 gi|5174421|ref|NP_006023.1| NP_006023.1.87134 NP_006023.1.92137 XP_005268273.1.92137 XP_009425814.1.37143 XP_009425815.1.37143 XP_018864873.1.27298 ENSP00000380211 ENSP00000216775 ENSP00000380211 ENSGGOP00000015579 9598.ENSPTRP00000010504 9600.ENSPPYP00000006455 9606.ENSP00000216775 ENSPPYP00000006455 HR5159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]