SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006487 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006487
Domain Number 1 Region: 1064-1264
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.6e-27
Family Reverse transcriptase 0.0023
Further Details:      
 
Domain Number 2 Region: 1608-1698
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000956
Family Retroviral integrase, catalytic domain 0.018
Further Details:      
 
Domain Number 3 Region: 1321-1450
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000055
Family Ribonuclease H 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006487   Gene: ENSPPYG00000005705   Transcript: ENSPPYT00000006743
Sequence length 1898
Comment pep:known_by_projection chromosome:PPYG2:14:23878130:23897275:1 gene:ENSPPYG00000005705 transcript:ENSPPYT00000006743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGGDPPAQEWFMVQTKSKPRVQRQRLQVQRIFRVKLNAFQSRPDTPYFWLQLEGPRE
NMGKAKEYLKGLCSPELWKEVRYPPILHCAFLGAQGLFLDCLCWSTLAYLVPGPPGSLMV
GGLTESFIMTQNWLEELVGRLRWGPAPLLTPRGIWEAEVTRAFGALVWIRGDQHAGDLLQ
LPPAVQELLLSLVRDAAGKEDIIEWLSRFGISDSHSDPEVLICPPQQQKEAPAMVSVGES
PGPFVDMGTLQNRGPENSKRLSSLGATGSLIPAQSTPQEAANQLVRVGSNNQDGMDSAQE
EGPVQATSSQDSTSHTQALLKQRQVQKIEDKLLFQPPVSALGVCPPWKAWTPGPAFGPLW
PGAIAATFWRINELHSLHLAWLLSQACFNFPFWQRPLGPIQLKLPGQNPLPLNLEWKQKE
LAPLPSAESPAGRPDGGLGGEAALQNCPRPEIPPKVMSLLVVPGSSDVKDKVSLDLPQIG
PPLTSTPQLQAGGEPGDQGSMQLDCKGLEEGPAPVLPTGQGKPVAQGGLTDQSVLGAQTV
PETVKVPMAAAVPKAENPPRTPVPPAAPKVPTSRMMPAVHTEPAAPEVPLAPTKPTAQLM
ATVQKTVVNQPVLAAQVEPTTPKTPQAQKMPVAKTSTAGPKTPKAQAGPAATVSKAPAAS
KAPAAPKVPVTPRVSRAPKTPAAQKVPTDAGPTLDVAKLLSEVQPTSRASVSLSKGQGQA
GRQGPQPSGTLALSSKHQFQMEGLLGAWEGAPRQPPRHLQANSTVTSFQRYHEALNTPFE
LNLSGEPGNQGLRRVVIDGSSVAMVHGLQHFFSCRGIAMAVQFFWNRGHREVTVFVPTWQ
LKKNRRVRESHFLTKLHSLKMLSITPSQLENGKKITTYDYRFMVKLAEETDGIIVTNEQI
HILMNNSKKLMVKDRLLPFTFAGNLFMVPDDPLGRDGPTLDEFLKKPNRLDTDIGNFLKV
WKTLPPSSASVTELSDDSDSGTLESLPNMEEVREEKEERQDEEQRQGQGTQKAAEEDDLD
SSLASVFRVECPSLSEEILRCLSLHDPPDGALDIDLLPGAASPYLGIPWDGKAPCQQVLA
HLAQLTIPSNFTALSFFMGFMDSHRDAIPDYEALVGPLHSLLKQKPDWQWDQEHEEAFLA
LKRALVSALCLMAPNSQLPFRLEVTVSHVALTAILHQEHSGRKHPIAYTSKPLLPDEESQ
GPQSGGDSPYAVAWALKHFSRCIGDTPVVLDLSYASRTTADPEVREGRRVSKAWLIRWSL
LVQDKGKRALELALLQGLLGENRLLTPAASMPRFFQVLPPFSDLSTFVCIHMSGYCFYRE
DEWCAGFGLYVLSPTSPPVSLSFSCSPYTPTYAHLAAVACGLERFGQSPLPVVFLTHCNW
IFSLLWELLPLWRARGFLSSDGAPLPHPSLLSYIISLTSGLSSLPFIYRTSYRGSLFAVT
VDTLAKQGAQGGGQWWSLPKDVPAPTVSPHAMGKRPNLLALQLSDSTLADIIARLQAGQK
LSGSSPFSSAFNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDIPLGAHQRPE
ETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIESPWPLRSTAPWSNLQME
VVGPVTISEEGHKHVLIVADPNTRWVEAFPLKPYTHTAVAQVLLQHVFARWGVPVRLEAA
QGPQFARHVLVSCGLALGAQVASLSRDLQFPCLTSSGAYWEFKRALKEFIFLHGKKWAAS
LPLLHLAFRASSTDATPFKVLTGGESRLTEPLWWEMSSANIEGLKMDVFLLQLVGELLEL
HWRVADKASEKAENRRFKRESQEKEWNVGDQVLLLSLPRNGSSAKWVGPFYIGDRLSLSL
YRIWGFPTPEKLGCIYPSSLMKAFAKSGTPLSFKVLEQ
Download sequence
Identical sequences H2NKX2
ENSPPYP00000006487 XP_002824664.1.23681 ENSPPYP00000006487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]