SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006529 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006529
Domain Number 1 Region: 213-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000708
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 375-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000255
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006529
Domain Number - Region: 473-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00627
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006529   Gene: ENSPPYG00000005745   Transcript: ENSPPYT00000006786
Sequence length 516
Comment pep:known_by_projection chromosome:PPYG2:14:35286076:35287626:1 gene:ENSPPYG00000005745 transcript:ENSPPYT00000006786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTREEPGKGLTAEAAREQSGSPCRAAGVSSGTGGREGAEWRAGGREGSGPSPSPSPSPSP
SPAKPAGAELRRAFLERCLSSPVSAESFPGGAAAVAAFSCSVAPAAAPTSGEQFLLPLRA
PFPEPALQPDPAPLSAALQSLKRAAGGERRGKAPTGCASGPAAAGIKKPKAIRKLSFADE
VTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFICQLCKEQYADPFALAQHRCSRIVRVE
YRCPECDKVFSCPANLASHRRWHKPRPAAANAATVSSADGKPLSSSSSSSRDSGAIASFL
AEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLSQGPYTEGVLGRR
VPVPGSTSGGRGSEIFVCPYCHKKFRRQAYLRKHLSTHEAGSARALAPGFGSERGTPLAF
ACPLCGAHFPTADIREKHRLWHAVREELLLPALAGAPPETPGPSGPSDGSAQQIFSCKHC
PSTFLSSPGLTRHINKCHPSESRQVLLLQMPLRPGC
Download sequence
Identical sequences H2NL14
9600.ENSPPYP00000006529 ENSPPYP00000006529 ENSPPYP00000006529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]