SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006678 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006678
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000158
Family RING finger domain, C3HC4 0.0000291
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006678
Domain Number - Region: 87-112,145-179
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0327
Family CorA soluble domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006678   Gene: ENSPPYG00000005876   Transcript: ENSPPYT00000006941
Sequence length 288
Comment pep:known_by_projection chromosome:PPYG2:14:61464280:61727320:1 gene:ENSPPYG00000005876 transcript:ENSPPYT00000006941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRV
QLFEDPTVDKEVEIRKKVLKIYNKREEDFPTLREYNDFLEEVEEIVFNLTNNVDLDNTKK
KMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNK
QAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHK
LEEALYEYQPLQIETYGPHVPELEMLGRLGNFTDSDPQEFHLVYQCLI
Download sequence
Identical sequences H2NLF5
ENSPPYP00000006678 ENSPPYP00000006678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]