SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006751 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006751
Domain Number 1 Region: 87-258
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.06e-47
Family DnaQ-like 3'-5' exonuclease 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006751   Gene: ENSPPYG00000005937   Transcript: ENSPPYT00000007016
Sequence length 621
Comment pep:known_by_projection chromosome:PPYG2:14:70229343:70285949:1 gene:ENSPPYG00000005937 transcript:ENSPPYT00000007016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQNLVALTVTTLLGVAVGGFVLWKGIQRRRRNKTSPVTQQPQQKVLGSRELPPPEDDQ
LHSSAPRSSWEERILKAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLEGKASP
LSLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDILADGTILKVGVGCSEDASKLLQDYG
LVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQV
IYAARDAQISVALFLHLLGYPFSRNSPGEKNDDHSSWRKVLEKCQGVVDIPFRSKGMSRL
GEEVNGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPLYDNCFL
HAPDGQPLCTCDRRKAQWYLDKGIGELVSEEPFVVKLRFEPAGRPESPGDYYLMVKENLC
VVCGKRDSYIRKNVIPHEYRKHFPIEMKDHNSHDVLLLCTSCHAISNYYDNHLKQQLAKE
FQAPIGSEEGLRLLEDPERRQVRSGARALLNAESLPAHRKEELLQALREFYNADTVTEEI
LQEAASLETRISNENYVPHGLKVVQCHSQGGLRSLMQLESRWRQHFLDSMQPKHLPQQWS
VDHNHQKLLRKFEEDLPIQLS
Download sequence
Identical sequences H2NLM3
ENSPPYP00000006751 ENSPPYP00000006751 XP_002824929.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]