SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006756 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000006756
Domain Number - Region: 189-294
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00103
Family Myosin rod fragments 0.0087
Further Details:      
 
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily PH domain-like 0.00821
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006756   Gene: ENSPPYG00000005941   Transcript: ENSPPYT00000007021
Sequence length 434
Comment pep:known_by_projection chromosome:PPYG2:14:70525080:70569990:1 gene:ENSPPYG00000005941 transcript:ENSPPYT00000007021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYAMKISHQDFHGNILLAAESEFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQ
LAKEKQEYLDKLMEETEELCLQREQREELERLNQVLEAEKQQFEEVVQELRMEQEQIKRE
LELTARCLKGVEQEKKELRHLTESLQQTLEELSIEKKKTLEMLEENENHLQTLANQSEQP
PPSGGLHSNLRQIEEKMQQLLEEKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQ
ELTAEKQQAERELKDLTSFSFPSPQPQAEVKVRMDLERRLREAEGALRSLEQGLNSKVRN
KEKEERMRADVSHLKRFFEECIRNAELEAKMPVIMKNSVYIHKAATRRIKSCRFHRRRSS
TSWNDSECGCLRALDVEAACWAPVSPVKPSQSFMTSQLDANNMEELKEVAKRLSRDQRFR
ESIYHIMVTQPGAP
Download sequence
Identical sequences H2NLM8
ENSPPYP00000006756 ENSPPYP00000006756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]