SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006774 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006774
Domain Number 1 Region: 480-824
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 4.05e-116
Family Rap/Ran-GAP 0.000000541
Further Details:      
 
Domain Number 2 Region: 953-1027
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000133
Family PDZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000006774
Domain Number - Region: 1735-1783
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0837
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006774   Gene: ENSPPYG00000005960   Transcript: ENSPPYT00000007042
Sequence length 1804
Comment pep:known_by_projection chromosome:PPYG2:14:72693579:72855680:1 gene:ENSPPYG00000005960 transcript:ENSPPYT00000007042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLKRSQTERPLATDRASVVGTDGTPKVHTDDFYMRRFRSQNGSLGSSVLAPVGPSRSE
GSHHITSTPGVPKMGVRARIADWPPRKENIKESSRSSQEIETSSCLDSLSSKSSPVSQGS
SVSLNSNDSAMLKSIQNTLKNKTRPSENMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTP
TKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGEELGKSSDLEDNRSEDSVRPWACPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLSMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESASFESTLSSHCTNAGVAVLEVPKENLVLHLDRVKRY
IVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPDEMKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVVPELNVQCLRLAFNTPKVTEQLM
KLDEQGLNYQQKVGIMYCKAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQ
LDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGA
QPFSPKNIRSHFQHVFVIVRVHNPCSDSVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVF
RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASK
KKEKSKPYPGAELSSMGAIVWAVRAEDYNKAMELDCLLGISNEFIVLIEQETKSVVFNCS
CRDVIGWTSTDTSLKIFYERGECVSVGSFINNEEIKEIVKRLQFVSKGCESVEMTLRRNG
LGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTV
KVVIIPPHDDCTPRRSCSETYRMPVMEYKMNEGVSYEFKFPFRNNNKWQRNASKGPHSPQ
VPSQVQSPMTSRLNAGKGDGKMPPPERAANIPRSISSDGRPLERRLSPGSDIYVTVSSMA
LARSQCRNSPSNLSSSSDTGSVGGTYRQKSMPEGFGVSRRSPASIDRQNTQSDIGGSGKS
TPSWQRSEDSIADQMAYSYRGPQDFNSFVLEQHEYTEPTCHLPAVSKVLPAFRESPSGRL
MRQDPVVHLSPNKQGHSDSHYSSHSSSNTLSSNASSAHSDEKWYDGDRTESELNSYNYLQ
GTSADSGIDTTSYGPSHGSTASLGAATSSPRSGPGKEKVAPLWHSSSEVISMADRTLETE
SHGLDRKTESSLSLDIHSKSQAGSSPLTRENSTFSINDAASHTSTMSSRHSASPVVFTSA
RSSPKEELHPAAPSQLAPSFSSSSSSSSGPRSFYPRQGATSKYLIGWKKPEGTINSVGFM
DTRKRHQSDGNEIAHTRLRASTRDLRASPKPTSKSTIEEDLKKLIDLESPTPESQKSFKF
HALSSPQSPFPSTPTSRRALHRTLSDESIYSSQREHFFTSRASLLDQALPNDVLFSSTYP
SLPKSLPLRRPSYTLGMKSLHGEFSASDSSLTDIQETRRQPMPDPGLMPLPDTAADLDWS
NLVDAAKAYEVQRASFFAASDENHRPLSAASNSDQLEDQALAQMKPYSSSKDSSPTLASK
VDQLEGMLKMLREDLKKEKEDKAHLQAEVQHLREDNLRLQEESQNASDKLKKFTEWVFNT
IDMS
Download sequence
Identical sequences H2NLP4
ENSPPYP00000006774 XP_002824954.1.23681 XP_009247503.1.23681 9600.ENSPPYP00000006774 ENSPPYP00000006774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]