SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006783 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006783
Domain Number 1 Region: 1022-1104
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 720-779
Classification Level Classification E-value
Superfamily BPTI-like 1.2e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 3 Region: 1108-1195
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-18
Family I set domains 0.056
Further Details:      
 
Domain Number 4 Region: 888-968
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000212
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 275-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000536
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 339-397
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000693
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 7 Region: 27-75
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000994
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 8 Region: 459-511
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 396-453
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006783   Gene: ENSPPYG00000005968   Transcript: ENSPPYT00000007051
Sequence length 1251
Comment pep:known_by_projection chromosome:PPYG2:14:74390847:74423632:1 gene:ENSPPYG00000005968 transcript:ENSPPYT00000007051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLVPLLLAPAPGSSAPKVRRQSDTWGPWGQWSPCSRTCGGGVSFRERPCYSQRRDG
GSSCVGPARSHRSCRTESCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYGAPNKCELNC
IPKGENFYYKHREAVVDGTPCEPGKRDVCVDGSCRVVGCDHELDSSKQEDKCLRCGGDGT
TCYPVTGTFDANDLSRAVKNVRGEYYLNGHWTIEAARALPAASTILHYERGAEGDLAPER
LHARGPTSEPLVIELISQEPNPGVHYEYHLPLRHPGPGFSWSHGSWSDCSVECGGGHQSR
LVFCTIDHEAYPDYMCQHQPRPADRRSCNLHPCPETKRWKAGPWAPCSASCGGGSQSRSV
YCISSDGAGVQEAVEEAECAGLPGKPPAIQDCNLQRCAAWSLEPWGKCSVSCGVGIRKRS
VTCRGDRGSLLHTAACSLEDRPPLTEPCVHEDCPLLSDQAWHVGTWGLCSKSCSSGTRRR
QVVCAIGPPSHCGSLQHSKPVDVEPCNTQPCHLPQEVPSMQDVHTPASNPWMPLGPQESP
PSDSRGQWWAAQEHPSARGDHRGERGDPRGDEGTRLSALGTAPSLQQPPYQQPLRSGSGP
HDCRHSPHGCCPDGHTASLGPQWQGCPGAPCQQSRYGCCPDRVSVGEGPHHAGCTKSYGG
DSTGGRPRSRAVASTVHNTHQPQAQQNEPSECRGSQFGCCYDNMATAAGPLGEGCVGQPS
HAYPVRCLLPSAHGSCTDWAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQES
LHGPRRPQPGASGRSTHTDGGGSSPAGEQEPSQHRTGAVVQRKPWPSGGLWRQDQQPGLG
EAPHTHAFGEWPWGQELGSRAPGLGGDAGSLAPPFHSSSYRISLAGVEPSLVQAALGQSV
RLSCSDDTAPESQAAWQKDGQPISSDRHRLQSDGSLIIHPLQAEDVGTYSCGSTRPGRNS
QKIQLRIIGGDVAVLSQAELSRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQ
NQPRVVDASPGQRIRMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDGSLVISRVAVEDG
GFYTCVAFNGQDQDQRWVQLRVLGELTISGLPPTVTVPEGDTARLSCVVAGESVNIRWSR
NGLPVQADGHHVHQSPDGTLLIYNLRARDEGSYTCSAYQGSQAVSRSTEVKVVSPAPTAQ
PRDPGRDCVDQPELANCDLILQAQLCGNEYYSSFCCASCSRFQPHAQPIWQ
Download sequence
Identical sequences H2NLQ3
ENSPPYP00000006783 ENSPPYP00000006783 9600.ENSPPYP00000006783 XP_002824962.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]