SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006855 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006855
Domain Number 1 Region: 248-284
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006855   Gene: ENSPPYG00000006027   Transcript: ENSPPYT00000007124
Sequence length 490
Comment pep:known_by_projection chromosome:PPYG2:14:78664140:78688053:-1 gene:ENSPPYG00000006027 transcript:ENSPPYT00000007124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALRDRAGLLLCVLLLATLLAAARGLPVKKPRLRGPRPGSLTRLVEASASPDPRPLREE
EEAPLLPRTHLQAEPHQYGRWTVTEPAALTPGNATLPTTQEVTPLLLELQKLPGLVHATL
STPNPDIQVTIKVVEDPQAEVEIDLLAEPSNPPPQDTLSWLPTLWSFLWGDYEGEEKDRA
PGENGEEKEEDKDYPSEEIEGEDQEDKEEDEEEQALWFKGTTDNWDQGRLASGDWVLKDS
LSYDYEPQEEWSPWSPCSGNCSTGKQQRTRPCGYGCSATETRTCDLPSCPGTEDKDTLGL
PSEEWQLLARNATDMHDQDVDSCEKWLNCKSDFLIKYLSQMLRDLPSCPCAYPLEAMDSP
VSLQDEHQGRSFRWRDASGPRERLDIYQPTARFCLRSMLSGESSTLAAQHCCYDEDSRLL
TRGKGAGMPNLISTDFSRKLHFKFDTTPWILCKGDWSRLHAVLPPNNGRACTDNPLEEEY
LAQLQEAKEY
Download sequence
Identical sequences H2NLX1
ENSPPYP00000006855 XP_002825021.1.23681 9600.ENSPPYP00000006855 ENSPPYP00000006855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]