SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006970 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006970
Domain Number 1 Region: 796-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000165
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 427-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000026
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 834-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000249
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006970   Gene: ENSPPYG00000006131   Transcript: ENSPPYT00000007245
Sequence length 893
Comment pep:known_by_projection chromosome:PPYG2:14:100662966:100770379:-1 gene:ENSPPYG00000006131 transcript:ENSPPYT00000007245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQGNPQHLSQRELITEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQC
QMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVTP
DEDDHLLSPTKGICPKQENIAGPCRPAQLPAVAPIAVSSHSHSSVITSPLRALGALPPCL
PLPCCSARPVSGDGTQGEGQTEAPFGCQCQLSGKDEPSSYICTTCKQPFNSAWFLLQHAQ
NTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLMNFLGDSNPFNLLRMTGPILRD
HPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPAM
DFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPPGGTPPPQ
PPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKA
GSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEE
EELLLENESRPESSFSMDSELSRNRENGGGGVAGVPGAGGGAAKALADEKALVLGKVMEN
VGLGALPQYGELLADKQKRGAFLKRAAGGGDAGDDDDAGGCGDAGAGGAVNGRGGGFAPG
TEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAALIPSENVYSQWLVGYAASRHF
MKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLGG
PGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTR
HMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS
Download sequence
Identical sequences H2NM81
9600.ENSPPYP00000006970 XP_009247747.1.23681 ENSPPYP00000006970 ENSPPYP00000006970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]