SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006985 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000006985
Domain Number - Region: 4-94
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00942
Family Myosin rod fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006985   Gene: ENSPPYG00000006144   Transcript: ENSPPYT00000007260
Sequence length 591
Comment pep:known_by_projection chromosome:PPYG2:14:102070799:102102181:-1 gene:ENSPPYG00000006144 transcript:ENSPPYT00000007260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRI
QSNYMALQRINQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELY
RKDCNLAAQLLQCSQTYGRVHKVSEVPSDFQERVSLHIEKHRCRLPSPLCHPTYADSVPT
CVIPKVLEKPDPASLSSRLSDASARDLAFDGVEKPGPQTPYKGDIYSNTALYCPEERRRD
RRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSYSS
FSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPLEA
EVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLS
VEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDL
SQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGAASSPEPEQGSR
DSLEPSSMEASPEMHPAPRLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN
Download sequence
Identical sequences H2NM95
9600.ENSPPYP00000006985 ENSPPYP00000006985 ENSPPYP00000006985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]