SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007005 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007005
Domain Number 1 Region: 2-310
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-70
Family Protein kinases, catalytic subunit 0.00000485
Further Details:      
 
Domain Number 2 Region: 928-985
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.39e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 1005-1119
Classification Level Classification E-value
Superfamily PH domain-like 0.000000108
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 4 Region: 1153-1318,1370-1408
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000085
Family Tricorn protease domain 2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007005
Domain Number - Region: 463-572
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00706
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 345-458
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007005   Gene: ENSPPYG00000006164   Transcript: ENSPPYT00000007284
Sequence length 1617
Comment pep:known_by_projection chromosome:PPYG2:14:104596258:104729912:-1 gene:ENSPPYG00000006164 transcript:ENSPPYT00000007284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNTERIYAMKILNKWEMLKRAETACFREERDVLVNGDCQWITALHYAFQDENHLYLVMD
YYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHI
RLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEM
LYGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIE
DFKKHAFFEGLNWENIRNLEAPYIPDVSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGL
HLPFIGFTFTTESCFSDRGSLKSIMQSNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEK
LELSRKLQESTQTVQSLHGSSRALSNSNRDKEIKKLNEEIERLKNKIADSNRLERQLEDT
VALRQEREDSTQRLRGLEKQHRVVRQEKEELHKQLVEASERLKSQAKELKDAHQQRKLAL
QEFSELNERMAELRAQKQKVSRQLRDKEEEMEVATQKVDAMRQEMRRAEKLRKELEAQLD
DAVAEASKERKLREHSENFCKQMESELEALKVKQGGRGAGATLEHQQEISKIKSELEKKV
LFYEEELVRREASHVLEVKNVKKEVHDSESHQLALQKEILMLKDKLEKSKRERHNEMEEA
VGTIKDKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLAAKKESVAHW
EAQIAEIIQWVSDEKDARGYLQALASKMTEELEALRSSSLGSRTLDPLWKVRRSQKLDMS
ARLELQSALEAEIRAKQLVQEELRKVKDSNLTLESKLKDSEAKNRELLEEMEILKKKMEE
KFRADTGLKLPDFQDSIFEYFNTAPLAHDLTFRTNSASEQETQAPKPEASPSMSVAASEQ
QEDMARPPQRPSAVPLPATQALALAGPKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGY
ACEVCSFACHVSCKDSAPQVCPIPPEQSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGW
QRAYAVVCDCKLFLYDLPEGKSTQPGVIASQVLDLRDDEFSVSSVLASDVIHATRRDIPC
IFRVTASLLGAPSKTSSLLILTENENEKRKWVGILEGLQSILHKNRLRNQVVHVPLEAYD
SSLPLIKAVLTAAIVDADRIAVGLEEGLYVIEVTRDVIVRAADSKKVHQIELAPREKIVI
LLCGRNHHVHLYPWSSLDGAEGSFDIKLPETKGCQLMATAILKRNSGTCLFVAVKRLILC
YEIQRTKPFHRKFNEIVAPGSVQCLAVLRDRLCVGYPSGFCLLSIQGDGQPLNLVNPNDP
SLAFLSQQSFDALCAVELESEEYLLCFSHMGLYVDPQGRRARAQELMWPAAPVACSCSPT
HVTVYSEYGVDVFDVRTMEWVQTIGLRRIRPLNSEGTLNLLNCEPPRLIYFKSKFSGAVL
NVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAH
MGPGDGMQVLMDLPLSAAPPSQEERPGPAPSNLARQPPSRNKPYISWPSSGGSEPGVTVP
LRSMSDPDQDFDKEPDSDSTKHSTPSNSSNPSGPPSPNSPHRSQLPLEGLEQPACDT
Download sequence
Identical sequences H2NMB5
XP_002825173.2.23681 ENSPPYP00000007005 ENSPPYP00000007005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]