SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007037 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007037
Domain Number 1 Region: 10-129
Classification Level Classification E-value
Superfamily POZ domain 1.73e-27
Family BTB/POZ domain 0.00082
Further Details:      
 
Domain Number 2 Region: 313-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 292-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000468
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007037
Domain Number - Region: 255-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0504
Family Classic zinc finger, C2H2 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007037   Gene: ENSPPYG00000006193   Transcript: ENSPPYT00000007317
Sequence length 379
Comment pep:known_by_projection chromosome:PPYG2:14:106578270:106580031:1 gene:ENSPPYG00000006193 transcript:ENSPPYT00000007317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCPCDDGGGMEFPEHGGRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHL
FYRDRPAGSRDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIV
KVCKGRLQEKDRSLDPGNPAPGAEPAQPPCHWPVWTADLCPAARKAKLPPFGVKAALPPR
ASGPPPCQVPEESDQALDLSLKSGPRQERVHPPCVLLTPFCRAQPLLKDERDSLSEQEES
SSSRSPHSPPKPPPLCSKLFPSSHVLQLHLSAHFRERDSTRARLSPDGVAPTCPLCGKTF
SCTYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHTVVHTREKPHACRWCERRFTQSG
DLYRHIRKFHCGLVKSLLV
Download sequence
Identical sequences H2NME6
ENSPPYP00000007037 ENSPPYP00000007037 9600.ENSPPYP00000007037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]