SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007064 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007064
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-46
Family V set domains (antibody variable domain-like) 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007064   Gene: ENSPPYG00000006222   Transcript: ENSPPYT00000007348
Sequence length 100
Comment pep:known_by_projection chromosome:PPYG2:14:108658977:108659276:-1 gene:ENSPPYG00000006222 transcript:ENSPPYT00000007348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVARIRNKANSYTT
EYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Download sequence
Identical sequences H2NMH3
ENSPPYP00000007064 ENSPPYP00000007064 9600.ENSPPYP00000007064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]