SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007178 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007178
Domain Number 1 Region: 955-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-107
Family Thrombospondin C-terminal domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-39
Family Laminin G-like module 0.00000000463
Further Details:      
 
Domain Number 3 Region: 833-953
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.79e-37
Family TSP type-3 repeat 0.000000129
Further Details:      
 
Domain Number 4 Region: 489-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.49e-17
Family TSP-1 type 1 repeat 0.0000131
Further Details:      
 
Domain Number 5 Region: 435-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.79e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 6 Region: 764-834
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000772
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000387
Family VWC domain 0.0077
Further Details:      
 
Domain Number 8 Region: 691-775
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000235
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 379-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 10 Region: 547-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000408
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007178   Gene: ENSPPYG00000006338   Transcript: ENSPPYT00000007477
Sequence length 1170
Comment pep:known_by_projection chromosome:PPYG2:15:35931911:35949432:1 gene:ENSPPYG00000006338 transcript:ENSPPYT00000007477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGLGILFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPAGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSEPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
Download sequence
Identical sequences H2NMT2
ENSPPYP00000007178 XP_002825327.1.23681 9600.ENSPPYP00000007178 ENSPPYP00000007178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]