SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007228 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007228
Domain Number 1 Region: 74-260
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.48e-70
Family T-box 0.00000151
Further Details:      
 
Domain Number 2 Region: 2389-2469
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000406
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007228   Gene: ENSPPYG00000006380   Transcript: ENSPPYT00000007527
Sequence length 3030
Comment pep:known_by_projection chromosome:PPYG2:15:38073511:38226415:1 gene:ENSPPYG00000006380 transcript:ENSPPYT00000007527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKQQIILANQDGGTVAGAAPTFFVILKQPGNGKTDQGILVTNQDACALASSVSSPVKS
KGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNSKPQRDGKQKNSSDQEGNNISSSSGHRVRLTEGQGS
EIQPGDLDPLSRGHETSGKGLEKTSLNIKRDFLGFMDTDSALSEVPQLKQEISECLIASS
FEDDSHVASPLDQNGSFNVVIKEEPLDDYDYELGECPEGVTVKQEETDEETDVYSNSDDD
PILEKQLKRHNKVDNPEADHLSSKWLPSSPSGVAKAKMFKLDTGKMPVVYLEPCAVTRST
VKISELPDNMLSTSRKDKSSMLAELEYLPTYIENSNETAFCLGKESENGLRKHSPDLRVV
QKYPLLKEPQWKYPDISDSISTERILDGSKSSVGDSLSGKEDLGRKRTTMLKIATAAKVV
NANQNASPNVPGKRGRPRKLKLCKAGRPPKNTGKSLISTKNTPVGPGSTFPDVKPDLEDV
DGVLFVSFESKEALDIHAVDGTTEESSSLQASTQTNDSGYRARISQLEKELIEDLKSLRH
KQVIHPGLQEVGLKLNSVDPTMSIDLKYLGVQLPLAPATSFPFWNLTGTNPASPDTGFPF
VSRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSDKLDEYLENEGKLME
TSIGFSSNAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVPPASRKAK
SQNRQATFSGRAKSSYKSILPYPVSPKQKYSHMILGDKVTKNSSGIISENQANNFVVPTL
DENIFPKQISLRQAQQQQQQQQQGSRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERAD
VSLTTLLTAQASLKTKPIHTIIRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMF
GCTCLKRKVVLVKGGSKTKHFQRKAAHRDPVFYDTLGEETREEEEGIREEEEQLKEKKKR
KKLEYTICETEPEQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSPTV
KGKLLTGIKSARSYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYEPKKADQRQPSSSS
SPSPSFQQQSSCHSSPENHNNAKEPDSEQQPLKQLTCDLEDDSDKLQEKSWKSSCNEGES
SSTSYMHQRSPGGPTKLIEIISDCNWEEDRNKILSILSQHINSNMPQSLKVGSFIIELAS
QRKSRGEKNPPVYSSRVKISMPSCQDQDDMAEKSGSETPDGPLSPGKMEDISPVQTDALD
SVRERLHGGKGLPFYAGLSPAGKLVAYKRKPSSSTSGLIQVASNAKVAASRKPRTLLPST
SNSKMASSSGTATNRPGKNLKAFVPAKRPIAARPSPGGVFTQFVMSKVGALQQKIPGVST
PQTLAGTQKFSIRPSPVMVVTPVVSSEPVQVCSPVTAAVTTTTPQVFLENVTAVTPMTAI
SDVETKETTYSSGATTTGVVEVSETTNTSTPVTSTQSTATVNLTKTTGITTPVASVAFPK
SLVASPSTITLPVASTASTSLVVVTAAASSSMVTTPTSSLGSVPIILSGINGSPPVSQRP
ENAAQIPVATPQVSPNTVKRAGPRLLHPNGQIVQLLPLHQLRGSNTQPNLQPVMFRNPGS
VMGIRLPAPSKPSETPPSSTSSSAFSVMNPVIQAVGSSSAVNVITQAPSLLSSGASFVSQ
AGTLTLRISPPEPQSFASKTGSETKITYSSGGQPVGTASLIPLQSGSFALLQLPGQKPVP
SSILQHVASLQMKRESQNPDQKDETNSIKREQETKKVLQSEGEAVDPEANIIKQNSGAAT
SEETLNDSLEDRGDHLDEESLPEEGSATVKPSEHSCITGSHTDQDYKDVNEEYGARNRKS
SKEKVAVLEVRTISEKASNKTVQNLSKVQHQKLGDVKVEQQKGFDNPEENSSEFPGSFKE
ESKFELSGSKVMEQQSNLQPEAKEKECGYSLEKDSIRERWRKHLKGPLTRKCVGASQECK
KEADEQLIKETKTCQENSDVFQQEQGISDLLGKSGIAEDARVLKTECDSWSRISNPSAFS
IVPRRAAKSSRGNGHFQGHLLLPGEQIQPKQENGGRSSTDFTVLDLEEDDDHDNEKTDDS
IDEIVDVVSDYQSEEVDDVEKNNCVEYIEDDEEHVDIETVEEFSEEISVAHLKTTVAHTQ
SFKQPSCTHISADEKAAERSRKAPPIPLKLKPDYWSDKLQKEAEAFAYYRRTHTANERRR
RGEMRDLFEKLKITLGLLHSSKVSKSLILTRAFSEIQGLTDQADKLIGQKNLLTRKRNIL
IRKVSSLSGKTEEVVLKKLEYIYAKQQALEAQKRKKKMGSDEFDMSPRISKQQEGSSTSS
VDLGQMFINNRRGKPLILSRKKDQATENTSPSNTPHTSANLVMTPQGQLLTLKGPLFSGP
VVTVSPDLLESDLKPQVAGSAVALPENDDLFMMPRIVNVTSLATEGGLVDMGSSKYPHEV
PDGKPSDHLKDTVRNEDNSLEDKGRISSRGNRDGRVTLGPTQVFLANKDSGYPQIVDVSS
MQKAQEFLPKKISGDMRGIQYKWKESESRGERVKSKESSFHKLKMKDLKDSSIEMELRKV
TSAIEEAALDSSELLTNMEDEDDTDETLTSLLNEIAFLNQQLNDDSVSLAELPSSMDTEF
PGDARRAFISKVPPGNRAAFQVEHLGTGLKELPDVQGESDSISPLLLHLEDDDFSENEKQ
LAEPASEPDVLKIVIDSEIKDSLLSNKKAIDGGKNTSGLPAEPESVSSPPTLHMKTGLEN
SNSTDTLWRPMPKLAPLGLKVANPSSDADGQSLKVMPCLAPIAAKVGSVGHKMNLTGNDQ
EGRESKVMPTLAPVVAKLGNSGASPSSAGK
Download sequence
Identical sequences H2NMX8
ENSPPYP00000007228 ENSPPYP00000007228 9600.ENSPPYP00000007228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]