SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007260 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007260
Domain Number 1 Region: 175-483
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-83
Family Transglutaminase core 0.000000822
Further Details:      
 
Domain Number 2 Region: 5-173
Classification Level Classification E-value
Superfamily E set domains 2.76e-44
Family Transglutaminase N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 503-615
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.04e-28
Family Transglutaminase, two C-terminal domains 0.0024
Further Details:      
 
Domain Number 4 Region: 617-715
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.68e-28
Family Transglutaminase, two C-terminal domains 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007260   Gene: ENSPPYG00000006407   Transcript: ENSPPYT00000007561
Sequence length 721
Comment pep:known_by_projection chromosome:PPYG2:15:39650773:39674669:-1 gene:ENSPPYG00000006407 transcript:ENSPPYT00000007561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGESSQHSTGLAGLYAAPAASPVFIRGSGMDALGIKSCDFLAARNNEEHHTKALSSRR
LFVRRGQPFTIILHFRAPVRAFLPALKKVALTAQTGEQPSMINRTQATFPISSLGDRKWW
SAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQYLLGQFTLLFNPWSREDAVFLK
NEAQRTEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLCLLSADKQVEKWSQPVH
VARVLGALLHYLKEKRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWV
LAAVACTVLRCLGIPARVVTTFASAQGTGGRLLVDEYYNEEGLQNGEGQRGRIWIFQTST
ECWMTRPALPQGYDGWQILHPSAPNGGKVLGFCDLVPVRAVKEGMLGLTPAVSDLFAAIN
ASCVVWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLER
VKKEKMEHGKDNGIRPPSLETANPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLA
IGVQAVHYNGVLAAKLWRKKLPLTLSANLEKTITINLFFSNFERNPPENTFLRLTAMATH
SESSLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSIQNSLDAPMEDCVISILGRGL
IHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELS
A
Download sequence
Identical sequences H2NN07
9600.ENSPPYP00000007260 ENSPPYP00000007260 ENSPPYP00000007260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]