SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007261 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007261
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.74e-129
Family Transglutaminase core 0.00000000683
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 3.43e-41
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 619-717
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-27
Family Transglutaminase, two C-terminal domains 0.0002
Further Details:      
 
Domain Number 4 Region: 506-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.21e-26
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007261   Gene: ENSPPYG00000006408   Transcript: ENSPPYT00000007562
Sequence length 720
Comment pep:known_by_projection chromosome:PPYG2:15:39687327:39720590:-1 gene:ENSPPYG00000006408 transcript:ENSPPYT00000007562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLEVALTDLQSSRNNVRHHTEEIAVDHLLVRRGQAFNLTLYFRNRGFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNEATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEEKIIDICLKLLDKSLHFQTDSATDCALRGSPVYISRVVCAMINSNDDNGVLNG
NWSENYTDGANPAEWTGSVAILKQWYATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQEMSNGVYCCGPASVRAVKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARRFHGSQRGAELQP
SRPTPLSQDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDIAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGS
GLFKKQQKVFLGVLKPQHRASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences H2NN08
9600.ENSPPYP00000007261 ENSPPYP00000007261 ENSPPYP00000007261 XP_002825414.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]