SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007377 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000007377
Domain Number - Region: 990-1091
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00128
Family Myosin rod fragments 0.0027
Further Details:      
 
Domain Number - Region: 1088-1155
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0217
Family Myosin rod fragments 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007377   Gene: ENSPPYG00000006506   Transcript: ENSPPYT00000007679
Sequence length 1199
Comment pep:known_by_projection chromosome:PPYG2:15:54294310:54397061:1 gene:ENSPPYG00000006506 transcript:ENSPPYT00000007679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELYFGEYQHVQQEYGVHLRLASDDTQKSRSSQNSKAGSYGVSIRVQGIDGHPYIVLNNT
ERCLAGTSFSENGPPFPPPVINNLPLHSSNGSVLKENSEELQLPENPYALPSPIRNFKQP
LLHEGKNGVLDRKDGSVKPSHVLNFQRHPELLQPYDPEKNELNLQNHQPFESNWLKTLTE
EGVNNKKPWTCFPKPSNSQPTSPSLEDPAKSGVTAIRLCSSVVIEDPKKQTSVCVNVQSC
TKDRVGEEALSTSGRPLTAHSPHAHPETKKTRPDVLPFRRQDSAGPVLDGARSRRSSSSS
TTPTSANSLYRFLLDDQECAIHADNVNRHENRRYIPFLPGTGRDIDTGSIPGVDQLIEKF
DQKPGLQRRGRSGKRNRINPDDRKRSRSVDSAFPFGLQGNSEYLTEFSRNLGKSSEHLLR
PSQVCRQRPLSQERRGKQSMGRTFAKLQGAAHGAPCAHSRPPQPNIDGKVLETKGSQEST
VIRAPSLGAQSKKEEEVVKTATATLMLQNRAAATLPDSGAKKISVKTFPSASNTQATPDL
LKGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGN
NQASNSTSEVKDLLEQKSKLTIEVAELQRQLQLEVKNQQNIKEERERMRANLEELRSQHN
KKVEENSTLQQRLEESEGELRRNLEELFQVMEREQHQTNVEVLASRSNTSEQDQAGTEMR
VKLLQEENEKLQGRSEELERRVAQLQRQIEDLKGDEAKAKEMLKKYEGEIRQLEEALVHA
RKEEKEAVSARRALESELEAAQGNLSRTTQEQKQLSEKLKEESEQKEQLRRLKNEMENER
WHLGKTIEKLQKEMADIVEASRTSTLELQNQLDEYKEKNRRELAEMQRQLKEKTLEAEKS
RLTAMKMQDEMRLMEEELRDYQRAQDEALTKRQLLEQTLKDLEYELEAKSHLKDDRSRLV
KQMEDKVSQLEMELEEERNNSDLLSERISRSREQMEQVRNELLQERAARQDLECDKISLE
RQNKDLKSRIIHLEGSYRSSKEGLVVQMEARIAELEDRLESEERDRANLQLSNRRLERKV
KELVMQVDDEHLSLTDQKDQLSLRLKAMKRQVEEAEEEIDRLESSKKKLQRELEEQMDMN
EHLQGQLNSMKKDLRLKKLPSKVLDDMDDDDDLSTDGGSLYEAPVSYTFSKDSAAASQI
Download sequence
Identical sequences H2NNC1
ENSPPYP00000007377 9600.ENSPPYP00000007377 ENSPPYP00000007377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]