SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007445 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007445
Domain Number 1 Region: 149-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 308-382
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000221
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 225-288
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000981
Family Pre-dockerin domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007445
Domain Number - Region: 491-549
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0053
Family Carboxypeptidase regulatory domain 0.053
Further Details:      
 
Domain Number - Region: 51-173
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.00811
Family Vitelline membrane outer protein-I (VMO-I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007445   Gene: ENSPPYG00000006564   Transcript: ENSPPYT00000007749
Sequence length 1182
Comment pep:known_by_projection chromosome:PPYG2:15:62300855:62316966:-1 gene:ENSPPYG00000006564 transcript:ENSPPYT00000007749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGTKACVFSFLVLEVTSVLGRQTMLTQSVRRVQPEKRNPSIFAKPADTLESPGEWTTWF
NIDYPGGKGDYERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCL
NREQRPGQNCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRTCLAE
MVSLCSEATEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFILHGAVSLPGGAPASG
ATVYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKVKFAPIVLTMPKTSLKAATIK
AEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPSPDKYYQYHNDTLLDPSLYKHESK
LVLKLQQHQAGEYFCKAKVMPGCESRCPPDVIGSSPDETPCNPVPESYLIRLPHDCFQNA
TNSFYYDVGHCPVKTCAGQQDNGIRCRDAVQNCCGISRTEEREIQCSGYTLPTKVAKECS
CQRCTETRSIVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQETERLVLTF
VDRLQKFVNTTKVLPFNRKGSAVFHEIKMLRRKEPITLEAMETNIIPLGEVVGEDPMAEL
EIPSRSFYRQNGEPYTGKVKASVTFLDPRNISTATAAQSDLNFINDEGDTFPLRTYGMFS
VDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWSLNPDTGLWEEEADFKFENQKR
NKREDRTFLVGNMEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQIQGVVISVINLE
PRTGFFSSPRAWGRFDSXLTGPNGACVPAFCDDHSPDAYSAYVLASLAGEELQAVESSPK
FNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLRA
CEEAPPSAAHFRFYQIEGDRYDYNTVPFNEYDPMSWTEDYLAWWPKPMEFRACYIKVKIV
GPLEVNVRSRNMGGTHRRTVGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRVD
RTLVKVIPQGSCRRASVNPMLHEYLVNHLPLAVNNNTSEYTMLAPLDPLGHNYGIYTVTD
QDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCVERQVGRQSAFQYLQSTPAQSP
AAGTVQGRVPSRRQQRARGGQRQRGVVASLRFPRVAQQPLIN
Download sequence
Identical sequences H2NNI4
9600.ENSPPYP00000007445 ENSPPYP00000007445 ENSPPYP00000007445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]