SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007466 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000007466
Domain Number - Region: 28-142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000317
Family G proteins 0.0087
Further Details:      
 
Domain Number - Region: 263-304
Classification Level Classification E-value
Superfamily Globin-like 0.0665
Family Globins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007466   Gene: ENSPPYG00000006584   Transcript: ENSPPYT00000007770
Sequence length 315
Comment pep:known chromosome:PPYG2:15:64357111:64416809:-1 gene:ENSPPYG00000006584 transcript:ENSPPYT00000007770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVPCALVTSCSSAFSGDQLVQHILGTEDLIVELTSNDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAEAWLPEVMILVCDRVSED
GINRQKAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDR
NQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAADRTESLSDHRGGASNTTDAQVDSIVDP
MLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG
GDRDEIEGLSSDEEH
Download sequence
Identical sequences H2NNK4
9600.ENSPPYP00000007466 ENSPPYP00000007466 ENSPPYP00000007466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]