SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007486 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007486
Domain Number 1 Region: 20-241
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-54
Family Ankyrin repeat 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007486
Domain Number - Region: 794-904
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00191
Family Myosin rod fragments 0.0032
Further Details:      
 
Domain Number - Region: 910-1025
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00654
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 1188-1241
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0398
Family Coronavirus S2 glycoprotein 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007486   Gene: ENSPPYG00000006603   Transcript: ENSPPYT00000007790
Sequence length 1403
Comment pep:known_by_projection chromosome:PPYG2:15:67953923:67999172:-1 gene:ENSPPYG00000006603 transcript:ENSPPYT00000007790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNCWFSCAPKNRHAADWNKYDDRLMKAAERGDVEKVSSILAKKGVNPGKLDVEGRSVFH
VVASKGNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKLLQYNCPTEHADLQ
GRTALHDAAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMSRPTICQLLIDRGADV
NSRDKQNRTALMLGCEYGCRDAVEVLIKNGADISLLDALGHDSSYYARIGDNLDILTLLK
TASENTNKGRELWKKGPSLQQRNLTHMQDEVNVKSHQREHQNIQDLEIENEDLKERLRKI
QQEQRILLDKVNGLQLQLNEEVMVADDLESEREKLKSLLAAKEKQHEESLRTIEALKNRF
KYLESDHLGSGSHFSNRKEDMLLKQGQMYMADAQCTSPGIPAHIQSRSMLRPLELSLPSQ
TSYSENEILKKELEAMRTFCESAKQDRLKLQNELAHKVAECKALALECERVKEDSDEQIK
QLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTSEAASGNHRLTEELKDQLKDLKIKY
EGASAEVGKLRNQIKQNEMIVEEFKRDEGKLIEENKRLQKELSTCEMEREKKGRKVTEME
GQAKELLAKLALSIPAEKFENMKSSLSNEVNEKAKKLVEMEREHEKSLSEIRQLKRELEN
VKAKLAQHVKLEEHEQVKSRLEQKSGELGKKITELTLKNQTLQKEIEKVYLDNKLLKEQA
HNLTIEMKNHYVPLKVSEDMKKSHDAIIDDLNRKLLDVTQKYTEKKLEMEKLLLENDSLS
KDVSRLETVFVPPEKHEKEITALKSNIVELKKQLSELKKKCGEDQEKIHALMSENTNLKK
MMSNQYVPVKTHEEIKMTLNNTLAKTNRELLDVKKKFEDLNQEFVKIKDKNEILKRNLEN
TQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKKE
LDTIQECIKVKYAPIVSFEECERKFKATEKELKDQLSEQTQKYSVSEEEVKKNKQENDKL
KKEIFTLQKDLRDKTVLIEKSHEMERTLSRKTDELNKQLKDLSKKYTEVKNVKEKLVEEN
AKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVTKLH
QLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEEVSKLQSEVQNTKQ
ALKKLETREVVDLSKYKATKSDLETQISSLNEKLANLNRKYEEVCEEVLHAKKKEISAKD
EKELLRFSIEQEIKDQKERCDKSLTTITELQRRIQESAKQIEAKDNKITELLNDVERLKQ
ALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLADADRQHQEVIAIYRTHLLSAAQ
GHMDEDVQEALLQIIQMRQGLVC
Download sequence
Identical sequences H2NNM4
XP_002825662.1.23681 ENSPPYP00000007486 ENSPPYP00000007486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]