SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007550 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007550
Domain Number 1 Region: 32-209
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 6.8e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007550   Gene: ENSPPYG00000006655   Transcript: ENSPPYT00000007857
Sequence length 221
Comment pep:known_by_projection chromosome:PPYG2:15:72441491:72466680:1 gene:ENSPPYG00000006655 transcript:ENSPPYT00000007857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRPGRLPELEATRPHMEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDI
PGLEVAVVTTERAKHFYSPQDIPVTLYSDADEWEMWKSRCDPVLHIDLRRWADLLLVAPL
DANTLGKVASGICDNLLTCVIRAWDRSKPLLFCPAMNTAMWEHPITVQQVDQLKVFGYVE
IPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQRSGFQQS
Download sequence
Identical sequences H2NNT7
ENSPPYP00000007550 ENSPPYP00000007550 XP_002825726.1.23681 XP_009248304.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]