SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007555 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007555
Domain Number 1 Region: 627-1021
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.61e-84
Family alpha-mannosidase, C-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 248-522
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-83
Family alpha-mannosidase 0.012
Further Details:      
 
Domain Number 3 Region: 523-624
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.52e-25
Family alpha-mannosidase, domain 2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007555
Domain Number - Region: 71-119
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0276
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007555   Gene: ENSPPYG00000006659   Transcript: ENSPPYT00000007862
Sequence length 1025
Comment pep:known chromosome:PPYG2:15:72824073:72836859:-1 gene:ENSPPYG00000006659 transcript:ENSPPYT00000007862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGASCPVAVLSSFLTPERLPYQEAV
QRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLT
KEGEKTSYVLTDRLGERDPRSLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSRAELAV
FHRDVHMLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPDQPETFPVAQALASR
FFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQL
PSTCPQAQQLEWVKSRYPGLYSRLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQG
QNFFLQEFGKMCSEFWLPDTFGYSAQLPQIMHGCGIRHFLSQKLSWNLVNSFPHHTFFWE
GLDGSRVLVHFPPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGGPTQTML
DRLKRLSNTDGLPRVQLSSPRQLFSALESDSEQLCTWVGELFLELHNGTYTTHAQIKKGN
RECERILHDVELLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQMVAEEAM
CHYEDIRSHGNTLLSAAAAALCAGEPGPEGLLIVNTLPWKRTEVMALPKPGGAHSLALVT
VPSMGYAPVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVKLDPTGRLTSLVLVASG
REAIAEGAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWF
LLQISPNSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHL
QRPTHYNTSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAP
DATADTGRHEFTYALMPHEAPSPAPATSWSAFSVSSPAVLLETVKQARGGIPQRRSLVLR
LYEAHGSHVDCWLHLSLPVQEAILCDLLERPDPAGHLTLRDSRLKLTFSPFQVLSLLLVL
QPPPH
Download sequence
Identical sequences H2NNU2
ENSPPYP00000007555 9600.ENSPPYP00000007555 ENSPPYP00000007555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]