SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007576 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007576
Domain Number 1 Region: 785-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000107
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007576   Gene: ENSPPYG00000006677   Transcript: ENSPPYT00000007884
Sequence length 1400
Comment pep:known chromosome:PPYG2:15:73866368:74432488:-1 gene:ENSPPYG00000006677 transcript:ENSPPYT00000007884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDDGKPKCQTGGKSKRTIQGTH
KTTKQSTAVDCKITSSMTGDKHFDKSPTKTRHPRKIDLRARYWAFLFDNLRRAVDEIYVT
CESDQSVVECKEVLMMLDNYVRDFKALIDWIQLQEKLEKTDAQSRPTSLAWEVKKMSPGR
HVIPSPSTDRINVTSNARRSLNFGGSTGTVPAPRLAPTGVSWADKVKAHHTGSTASSEIT
PAQSCPPMTVQKASRKNERKDAEGWETVQRGRPIRSRSTAVMPKVSLVTEAARSKDDSDK
ENVCLLPDESIREGEFVGDGSSNTIESHCKDSLHSCDHPLAEKTQFTVSTLDDVKNSGSI
QDNYVRTSEISAVHIDTECVSVMLQADAPPLQVNEEKFPAEKARIENEMDPSDISNSMAE
VLAKKEELADRLEKANEEAIASAIAEEEQLTREIEAEENNDINIETDNDSDFSASMGSGS
VSFCGMSMDWNDVLADYEARESWRQNTSWGDIVEEEPARPPGHGIHMHEKLSSPSRKRTI
AESKKKHEEKQMKAQQLREKLREEKTLKLQKLLEREKDVRKWKEELLDQRRRMMEEKLLH
AEFKREVQLQAIVKKAQEEEAKVNEIAFINTLEAQNKRHDVLSKLKEYEQRLNELQEERQ
RRQEEKQARDEAVQERKRALEAERQARVEELLMKRKEQEARIEQQRQEKEKAREDAARER
ARDREERLAALTAAQQEAMEELQKKIQLKHDESIRRHMEQIEQRKEKAAELSSGRHANTD
YAPKLTPYERKKQCSLCNVLISSEVYLFSHVKGRKHQQAVRENTSIQGRELSDEEVEHLS
LKKYIIDIVVESTAPAEALKDGEERQKNKKKAKKIKARMNFRAKEYESLMETKNSGSDSP
YKAKLQRLAKDLLKQLQVQDSGSWANNKVSALDRTLGEITRILEKENVADQIAFQAAGGL
TALEHILQVVVPATNVNTVLRIPPKSLCNAINVYNLTCNNCSENCIDVLFSNKITFLMDL
LIHQLTVYVPDENNTILGRNTNKQVFEGLTTGLLKVSAVVLGCLIANRPDGNCQPAIPKI
PTQEMKNKPSQGDPFNSRVQDLISYVVNMGLIDKLCACFLSVQGPVDENPKMAIFLQHAA
GLLHAMCTLCFAVTGRSYSIFDNNRQDPTGLTAALQATDLAGVLHMLYCVLFHGTILDPS
TASPKENYTQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHCSQ
VSCESLLHEVIVCVGYFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQYFSDPRLIKVLFPS
LIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQAENQPYQPKGKCLGSQDYLELAN
RFPQQAWEEARQFFLKKEKK
Download sequence
Identical sequences H2NNW3
ENSPPYP00000007576 ENSPPYP00000007576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]