SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007582 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007582
Domain Number 1 Region: 89-172
Classification Level Classification E-value
Superfamily HMG-box 2.09e-25
Family HMG-box 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007582   Gene: ENSPPYG00000006683   Transcript: ENSPPYT00000007891
Sequence length 347
Comment pep:known_by_projection chromosome:PPYG2:15:74977679:75045659:1 gene:ENSPPYG00000006683 transcript:ENSPPYT00000007891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGTTSSTNNPEFVEDLSQGQL
LQSESSNAAEGNEQRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQ
LRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFS
RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSKAREAELRQLR
KSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTVLQQHLETLRQVLTSSFASMP
LPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR
Download sequence
Identical sequences A0A2K5IEE6 G1RAF6 H2NNW8
ENSPPYP00000007582 ENSNLEP00000010203 ENSPPYP00000007582 XP_002825755.1.23681 XP_003275487.1.23891 XP_009248336.1.23681 XP_011788220.1.43180 XP_011788221.1.43180 XP_012362925.1.23891 XP_012362926.1.23891 9600.ENSPPYP00000007582 ENSNLEP00000010203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]