SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007619 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007619
Domain Number 1 Region: 230-332
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.33e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 56-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000537
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007619   Gene: ENSPPYG00000006714   Transcript: ENSPPYT00000007928
Sequence length 610
Comment pep:known_by_projection chromosome:PPYG2:15:77956232:78148995:1 gene:ENSPPYG00000006714 transcript:ENSPPYT00000007928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYI
KAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGI
ITFVDPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTK
NREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPV
PNLPAGVHETGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGS
PFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQI
PSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSS
GQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPRNERWSPHSQQH
FGQPISYARM
Download sequence
Identical sequences H2NP01
9600.ENSPPYP00000007619 ENSPPYP00000007619 ENSPPYP00000007619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]