SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007635 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000007635
Domain Number - Region: 82-144
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00157
Family Myosin rod fragments 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007635   Gene: ENSPPYG00000006726   Transcript: ENSPPYT00000007944
Sequence length 379
Comment pep:novel chromosome:PPYG2:15:79973383:79980318:-1 gene:ENSPPYG00000006726 transcript:ENSPPYT00000007944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPQPRLPPHPAMSEKTQQGKLAAAKKKLKEYWHRKSPGIPAGANRRKKINGSSPDTATS
GGYHSPGDATGIYGEGPASSATLKDLESQYQELAVALDSSSAIISQLSENINSLAHTLKE
EKHEIHRVQKLGRSLFKLKNQMAEPLAPEPPAGPSEVEQLQDETNHLRKELESVGRQLQA
EVENNQMLSLLNRRQEERLREQEERLHEQEERLCEQEERLCEQEERLREQEERLCEQEKL
PGQERLLEEVEKLLEQERRQEEQERLLERERLLDEVEELLEQERLREQDERLWQQETLWE
LERLRELERMLELGWEALYEQQAEPCSGFEELNNENKSTLQLEQQVKELKKPEVGSPGLL
PGVEKLLVQERRHEEQERL
Download sequence
Identical sequences H2NP16
ENSPPYP00000007635 ENSPPYP00000007635 9600.ENSPPYP00000007635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]