SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007650 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007650
Domain Number 1 Region: 850-923
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000084
Family I set domains 0.049
Further Details:      
 
Domain Number 2 Region: 1236-1305
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000141
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 626-686
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 1135-1213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000298
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 531-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 1346-1403
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000942
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number 9 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 687-746
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 1407-1464
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 12 Region: 742-807
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 13 Region: 1520-1575
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000641
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 14 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007650   Gene: ENSPPYG00000006742   Transcript: ENSPPYT00000007961
Sequence length 1611
Comment pep:known_by_projection chromosome:PPYG2:15:80995284:81391487:1 gene:ENSPPYG00000006742 transcript:ENSPPYT00000007961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWTSPWWLLIGMVFMHSTLLQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNTRSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
DDCPPDAEDFRAQQCSAYNDVQYQGRYYEWLPRYNDPAAPCALKCHARGQNLVVELAPKV
LDGTRCNTDSLDMCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVVENTTVEFQR
GSERQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKFI
PEPWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESP
AARELDIPLPEDSETTYDWEYAGFTPCTATCLGWHVGSWGPCSATCGVGIQTRDVYCLHP
GETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGGGTQNRRVTCRQLLTDG
SFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGAGIQRRKQVCQRLTAKG
RRVPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKR
INLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLGITKSGSLKIHSLA
APDIGVYRCIAGSAQETVVLKLIGTDNRLIARPAVREPMREYPGMDHNEANSLGVTWHKM
RQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQFEAAVKQGAYSMDT
AQFDELIRNMSQLMETGEVSDDLASQLIYQLVAELAKAQPTHVQWRGIQEETPPAAQLRG
ETGSVSQSSNAKNSGKLTFKPKGPVLMRQSQPPSISFNKTINSRIGNTVYITKRTEVINI
LCDLITPSEATYTWTKDGTLLQPSVKIILDGTGKIQIQNPTRKEQGIYECSVANHLGSYV
ESSSVLYAEAPVILSVERNITKPEHNHLSVVVGGIVEAALGANVTIRCPVKTWLKRGGSL
SGNVSLLFNGSLLLQNVSLENEGTYVCTATNALGKAVAMSALHLLERRWPESRIIFPQGH
KKYVLQATNTRTDSNDPTGEPLPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEV
SEALCDHLQKPLAGFEPCNIQDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQ
VVSPRACAPKDRPLGRKPCFGYPCVQWEPGNQCPGRCMGRAVRMQQRHTACQHNSSDSNC
DDRRRPTLRRNCTSGACDVCWHAGPWKPCTAACGRGFQSRKVDCIHTRSCKPVAERHCVQ
KKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDLYKQRCCQSCQEG
Download sequence
Identical sequences H2NP30
ENSPPYP00000007650 ENSPPYP00000007650 9600.ENSPPYP00000007650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]