SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007669 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007669
Domain Number 1 Region: 239-384
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000467
Further Details:      
 
Domain Number 2 Region: 68-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000661
Further Details:      
 
Domain Number 3 Region: 25-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000762
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007669   Gene: ENSPPYG00000006759   Transcript: ENSPPYT00000007981
Sequence length 384
Comment pep:novel chromosome:PPYG2:15:85549157:85564334:-1 gene:ENSPPYG00000006759 transcript:ENSPPYT00000007981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKG
YAGDHCETKCVEPLGMENGNIANSQISASSVRVTFLGLQHWVPELARLNRAGMVNAWTPS
SNDDNPWIQVNLLRRMWITGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFLHDVNKKHK
EFVGNWNKNVVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCASPGLKNSID
KQITASSSYKTWGLHVFSWNPSYARLDKQGNFNSWVAGSYGNDQWLQVDLGSPKEVTGII
TQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPIL
ARYVRILPVAWHNRIALRLELLGC
Download sequence
Identical sequences H2NP49
9600.ENSPPYP00000007669 ENSPPYP00000007669 ENSPPYP00000007669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]