SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007673 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007673
Domain Number 1 Region: 636-903,944-1099
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.78e-75
Family DNA polymerase I 0.0034
Further Details:      
 
Domain Number 2 Region: 37-67,95-216,250-325
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000331
Family DnaQ-like 3'-5' exonuclease 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007673   Gene: ENSPPYG00000006763   Transcript: ENSPPYT00000007985
Sequence length 1146
Comment pep:known_by_projection chromosome:PPYG2:15:85969174:85988978:-1 gene:ENSPPYG00000006763 transcript:ENSPPYT00000007985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEAAVRRSVEHLQKHGLWGQPAAPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEA
ANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGICPTLAV
AISPSAWYSWCSRRLVEERYSWTSQLSPADLIPLEVPAGASSPTQRDWQEQLVVGHNVSF
DRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQVQKSQ
RKARRGPAVSSWDWLDISSVNNLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLM
QYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLSEAQGTYE
ELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKL
PIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKETTELLPKRPQHLPGHPGWY
RKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAN
LPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLIPQEAGLAEEFLLTDNSAIWQTVEE
LDYLEVEAEAKMENLRAPVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLP
HKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMV
VWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSE
LKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHS
KTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLR
WYRLSDEGEWLVRELHLPVDRTEGGWISLQDLRKVQRETARKSQWRKWEVIAERAWKGGT
ESEMFNKLESIATSDIPRTPVLGCRISRALEPSAVREEFMTSRVNWVVQSSAVDYLHLML
VAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDL
PQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEK
RSQPGP
Download sequence
Identical sequences H2NP53
ENSPPYP00000007673 ENSPPYP00000007673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]