SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007686 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007686
Domain Number 1 Region: 141-616
Classification Level Classification E-value
Superfamily Sema domain 2.22e-164
Family Sema domain 0.00000000221
Further Details:      
 
Domain Number 2 Region: 618-671
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000994
Family Plexin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007686   Gene: ENSPPYG00000006776   Transcript: ENSPPYT00000007999
Sequence length 930
Comment pep:known_by_projection chromosome:PPYG2:15:86861876:86910351:1 gene:ENSPPYG00000006776 transcript:ENSPPYT00000007999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTPRRTEAVRPRLRVPRDCAGPAWQGGRVSGHSRKSGPAGGDDRALALTHSRSGGGGPR
GDSGADRGAELLPVSPAEPPEPEPRDTVAPALRVLRAAMGPRSWLAAPWGVLPPRPPLLL
LLLLLLLLQPPPPTWALSPRISLPLGSEERPFLRFEAENISNYTALLLSRDGRTLYVGAR
EALFALNSNLSFLPGGEYQELLWGADAEKKQQCSFKGKDPQRDCQNYIKILLPLSGSHLF
TCGTAAFSPMCTYINVENFTLARDEKGNVLLEDGKGRCPFDPNFKSTALVVDGELYTGTV
SSFQGNDPAISRSQSLRPTKTESSLNWLQDPAFVASAYIPESLGSLQGDDDKIYFFFSET
GQEFEFFENTIVSRVARICKGDEGGERVLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFT
LSPSPQDWRDTLFYGVFTSQWHRGTTEGSAVCVFTMKDVQRVFNGLYKEVNRETQQWYTV
THPVPIPRPGACITNSARERKINSSLQLPDRVLNFLKDHFLMDGQVRSRMLLLQPQARYQ
RVAVHRVPGLHHTYDVLFLGTGDGRLHKAVSVGPRVHIIEELQIFSSGQPVQNLLLDTHR
GLLYAASHSGVVQVPMANCSLYRSCGDCLLARDPYCAWSGSSCKHVSLYQPELAARPWIQ
DIEGASAKDLCSASSVVSLSFVPTGEKPCEQVQFQPNTVNTLACPLLSNLATRLWLHNGA
PVNASASCHVLPTGDLLLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDQGG
NVPVIISTSRVSAPAGGRASWGADKSYWKEFLVMCTLFVLAVLFPVLFLLYRHRNSMKVF
LKQGECASVHPKTCPVVLPPETRPLNGLGPPSTPLDHRGYQALSDSPPGARVFTESEKRP
LSIQDSFVEVSPVCPRPRVRLGSEIRDSVV
Download sequence
Identical sequences H2NP65
ENSPPYP00000007686 ENSPPYP00000007686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]