SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007722 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007722
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 4.58e-29
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007722   Gene: ENSPPYG00000006809   Transcript: ENSPPYT00000008038
Sequence length 133
Comment pep:known_by_projection chromosome:PPYG2:15:96064713:96104118:-1 gene:ENSPPYG00000006809 transcript:ENSPPYT00000008038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAAKAIILEQSGKNQGYRDADIRGFRPEGGVCLPGGPDVLESGVCMKAVCKRVAVEGV
EVIFSRDAGRYVCDYTYYLSLQHGKGCAALIHVPPLSRRLPTSLLGRALQVIIQEMLEEE
EVSEDCLAACHNI
Download sequence
Identical sequences H2NPA0
9600.ENSPPYP00000007722 ENSPPYP00000007722 ENSPPYP00000007722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]