SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007749 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007749
Domain Number 1 Region: 306-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.42e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000967
Further Details:      
 
Domain Number 2 Region: 590-697
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.09e-26
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 3 Region: 225-305
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.79e-23
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0019
Further Details:      
 
Domain Number 4 Region: 163-223
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000218
Family TGS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007749   Gene: ENSPPYG00000006830   Transcript: ENSPPYT00000008066
Sequence length 707
Comment pep:known_by_projection chromosome:PPYG2:15:98896110:98967349:-1 gene:ENSPPYG00000006830 transcript:ENSPPYT00000008066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEALAAEAVASRLERQEEDIRWLWSEVQRLRDEQLNAPYSCQAEGPCLTREVAQLRAE
NRDLRHRLCSLRLCLAEERSRQATLESAEVAAAQEAGAQPPSSQSQDKDVKKKKMKESEA
DSEVKHQPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTT
PYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEKVNTATTTVYRCGP
LIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRNWEKFQE
EAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPN
MYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFAD
FGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQL
NLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYH
QCATIQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWL
SPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHNCTLNKKIRNAQLAQYNFILVV
GEKEKIDNAVNVRTRDNKIHGEILVTSAIDKLKNLKKTRTLNAEEDF
Download sequence
Identical sequences H2NPC7
ENSPPYP00000007749 ENSPPYP00000007749 9600.ENSPPYP00000007749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]